Procoagulant fusion compound

• US 10,584,147 B2
• Filed: 11/07/2014
• Issued: 03/10/2020
• Est. Priority Date: 11/08/2013
• Status: Active Grant

• Current Assignee: Bioverativ Therapeutics Inc. (Sanofi )
• Original Assignee: Bioverativ Therapeutics Inc. (Sanofi )
• Inventors: Thorn, Karina
• Primary Examiner(s): Szperka, Michael
• Application Number:
  US15/035,145
• Publication Number:
  US 20160289273A1
• Time in Patent Office: 1,950 Days
• Field of Search: None
• CPC Class Codes: A61K 38/00 Medicinal preparations containing peptides peptides containing beta-lactam rings A61K31/00; cyclic dipeptides not having in their molecule any other peptide link than those which form their ring, e.g. piperazine-2,5-diones, A61K31/00; ergot alkaloids of the cyclic peptide type A61K31/48; containing macromolecular compounds having statistically distributed amino acid units A61K31/74; medicinal preparations containing antigens or antibodies A61K39/00; medicinal preparations characterised by the non-active ingredients, e.g. peptides as drug carriers, A61K47/00
• CPC Class Codes: C07K 14/00 Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
• CPC Class Codes: C07K 2319/00 Fusion polypeptide
• CPC Class Codes: C07K 2319/30 Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto

Abstract

The present invention provides a fusion compound comprising a procoagulant compound and an immunoglobulin constant region or a portion thereof and methods of making and using the fusion compound. The fusion compounds of the present disclosure are useful for the treatment of coagulation disorders, such as hemophilia. In some aspects, the invention includes a method of reducing or preventing aggregates which comprise a procoagulant compound comprising fusing the procoagulant compound to an immunoglobulin constant region or a portion thereof wherein the procoagulant compound comprises an amino acid sequence. In another embodiment, the fusion compound forms less aggregates compared to a compound consisting of the procoagulant compound.

Claims

1. A polynucleotide encoding a fusion compound of the structure P-L1-F1-L2-F2, the fusion compound comprising a procoagulant compound (P), a first immunoglobulin constant region or portion thereof (F1), and a second immunoglobulin constant region or portion thereof (F2),

wherein P is linked through its C-terminal to the N-terminal of F1 with a first linker (L1) comprising an amino acid sequence as set forth in SEQ ID NO:

22,

wherein F1 is linked through its C-terminal to the N-terminal of F2 with a second linker (L2) comprising an amino acid sequence as set forth in SEQ ID NO;

22, and

wherein P comprises the amino acid sequence GSRIRTVSPGSRSASGKSTCLASYCWLFWTGIA (SEQ ID NO;

     4).

2. The polynucleotide of claim 1, which comprises pSYN-Fc-048 (SEQ ID NO:

1).

3. The polynucleotide of claim 1, wherein the first immunoglobulin constant region or portion thereof is an Fc fragment or an FcRn binding ligand.

4. The polynucleotide of claim 1, wherein the fusion compound comprises amino acids 22 to 558 of SEQ ID NO:

2.

5. The polynucleotide of claim 1, wherein the fusion compound further comprises a heterologous moiety.

6. The polynucleotide of claim 5, wherein the heterologous moiety comprises a polypeptide comprising FVIII, FIX, FVIIa, or a platelet targeting moiety.

7. The polynucleotide of claim 6, comprising the pSYN-FIX-030 nucleotide sequence of SEQ ID NO:

7.

8. The polynucleotide of claim 6, comprising the B-domain deleted FVIIIFc chain DNA sequence of SEQ ID NO:

11 or SEQ ID NO;

12.

9. The polynucleotide of claim 5, wherein the heterologous moiety is selected from polyethylene glycol (PEG), albumin, an XTEN moiety, a HES moiety, or a PAS moiety.

10. The polynucleotide of claim 5, wherein the heterologous moiety is linked to the procoagulant compound (P1) via a third linker (L3).

11. The polynucleotide of claim 5, wherein the heterologous moiety is linked to the first immunoglobulin constant region (F1) or second immunoglobulin constant region (F2) via a third linker (L3).

12. The polynucleotide of claim 1, wherein first linker (L1) and second linker (L2) are different.

13. The polynucleotide of claim 1, wherein first immunoglobulin constant region or portion thereof (F1) and second immunoglobulin constant region or portion thereof (F2) are the same.

14. The polynucleotide of claim 1, wherein first immunoglobulin constant region or portion thereof (F1) and second immunoglobulin constant region or portion thereof (F2) form an Fc region comprising amino acids corresponding to EU numbers 221-447 of human IgG1.

15. The polynucleotide of claim 1, wherein the fusion compound further comprises the signal peptide, METDTLLLWVLLLWVPGSTG (SEQ ID NO:

5).

16. A method of making a fusion compound, the method comprising

culturing a host cell in a culture medium under suitable conditions sufficient to produce the fusion compound, and

isolating the fusion compound from the culture medium, thereby producing the fusion compound,

wherein the host cell comprises a vector comprising a polynucleotide encoding a fusion compound of the structure P-L1-F1-L2-F2, the fusion compound comprising a procoagulant compound (P), a first immunoglobulin constant region or portion thereof (F1), and a second immunoglobulin constant region or portion thereof (F2),

wherein P is linked through its C-terminal to the N-terminal of F1 with a first linker (L1) comprising an amino acid sequence as set forth in SEQ ID NO:

22,

wherein F1 is linked through its C-terminal to the N-terminal of F2 with a second linker (L2) comprising an amino acid sequence as set forth in SEQ ID NO;

22, and

wherein P comprises the amino acid sequence GSRIRTVSPGSRSASGKSTCLASYCWLFWTGIA (SEQ ID NO;

     4).