Procoagulant fusion compound
First Claim
1. A polynucleotide encoding a fusion compound of the structure P-L1-F1-L2-F2, the fusion compound comprising a procoagulant compound (P), a first immunoglobulin constant region or portion thereof (F1), and a second immunoglobulin constant region or portion thereof (F2),wherein P is linked through its C-terminal to the N-terminal of F1 with a first linker (L1) comprising an amino acid sequence as set forth in SEQ ID NO:
- 22,wherein F1 is linked through its C-terminal to the N-terminal of F2 with a second linker (L2) comprising an amino acid sequence as set forth in SEQ ID NO;
22, andwherein P comprises the amino acid sequence GSRIRTVSPGSRSASGKSTCLASYCWLFWTGIA (SEQ ID NO;
4).
2 Assignments
0 Petitions
Accused Products
Abstract
The present invention provides a fusion compound comprising a procoagulant compound and an immunoglobulin constant region or a portion thereof and methods of making and using the fusion compound. The fusion compounds of the present disclosure are useful for the treatment of coagulation disorders, such as hemophilia. In some aspects, the invention includes a method of reducing or preventing aggregates which comprise a procoagulant compound comprising fusing the procoagulant compound to an immunoglobulin constant region or a portion thereof wherein the procoagulant compound comprises an amino acid sequence. In another embodiment, the fusion compound forms less aggregates compared to a compound consisting of the procoagulant compound.
-
Citations
16 Claims
-
1. A polynucleotide encoding a fusion compound of the structure P-L1-F1-L2-F2, the fusion compound comprising a procoagulant compound (P), a first immunoglobulin constant region or portion thereof (F1), and a second immunoglobulin constant region or portion thereof (F2),
wherein P is linked through its C-terminal to the N-terminal of F1 with a first linker (L1) comprising an amino acid sequence as set forth in SEQ ID NO: - 22,
wherein F1 is linked through its C-terminal to the N-terminal of F2 with a second linker (L2) comprising an amino acid sequence as set forth in SEQ ID NO;
22, andwherein P comprises the amino acid sequence GSRIRTVSPGSRSASGKSTCLASYCWLFWTGIA (SEQ ID NO;
4). - View Dependent Claims (2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15)
- 22,
-
16. A method of making a fusion compound, the method comprising
culturing a host cell in a culture medium under suitable conditions sufficient to produce the fusion compound, and isolating the fusion compound from the culture medium, thereby producing the fusion compound, wherein the host cell comprises a vector comprising a polynucleotide encoding a fusion compound of the structure P-L1-F1-L2-F2, the fusion compound comprising a procoagulant compound (P), a first immunoglobulin constant region or portion thereof (F1), and a second immunoglobulin constant region or portion thereof (F2), wherein P is linked through its C-terminal to the N-terminal of F1 with a first linker (L1) comprising an amino acid sequence as set forth in SEQ ID NO: - 22,
wherein F1 is linked through its C-terminal to the N-terminal of F2 with a second linker (L2) comprising an amino acid sequence as set forth in SEQ ID NO;
22, andwherein P comprises the amino acid sequence GSRIRTVSPGSRSASGKSTCLASYCWLFWTGIA (SEQ ID NO;
4).
- 22,
Specification