Immunoprotective methods for beta cell neogenesis

• US 20030212000A1
• Filed: 05/09/2003
• Published: 11/13/2003
• Est. Priority Date: 05/09/2002
• Status: Abandoned Application

• Current Assignee: Medtronic Minimed Incorporated (Medtronic Plc)
• Original Assignee: Medtronic Minimed Incorporated (Medtronic Plc)
• Inventors: Van Antwerp, William P.
• Application Number:
  US10/434,906
• Publication Number:
  US 20030212000A1
• Time in Patent Office: Days
• US Class Current: 514/12
• CPC Class Codes: A61K 38/1709 from mammals

Abstract

The invention is based on the disclosure provided herein that a biologically active fragment of pancreatitis associated polypeptide can be used to stimulate beta cell growth and at the same avoid and overcome the T-cell mediated autoimmune attack on the pancreas. Typical embodiments of the invention include methods of inhibiting the onset of Type I diabetes in a mammalian subject predisposed to Type I diabetes comprising administering to the subject a therapeutically effective amount of a pancreatitis associated polypeptide comprising the amino acid sequence IGLHDPTQGTEPNGE (SEQ ID NO: 3).

Claims

1. A method of using a pancreatitis associated peptide to facilitate the growth of a pancreatic cell in a mammal in a manner that simultaneously minimizes the immunostimulation of a leukocyte produced by the mammal that immunospecifically recognizes an epitope present on a pancreatitis associated protein having homology to the pancreatitis associated peptide, the method comprising:

(a) administering to the mammal a pancreatitis associated peptide comprising the amino acid sequence IGLHDPTQGTEPNGE (SEQ ID NO;

     3), wherein the pancreatitis associated peptide can facilitate the growth of the pancreatic cell;

wherein

(b) the mammal produces a leukocyte that immunospecifically recognizes an epitope present on the homologous pancreatitis associated protein comprising the sequence MLPPMALPSVSWMLLSCLMLLSQVQGEEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWT DADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWS SSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCIFTD (SEQ ID NO;

     1), wherein the epitope is not present on the pancreatitis associated peptide of step (a),

so that the administration of the pancreatitis associated peptide facilitates the growth of the pancreatic cell but does not immunospecifically stimulate the leukocyte to the same degree as an equivalent amount of the homologous pancreatitis associated protein.

2. The method of claim 1, wherein the leukocyte that immunospecifically reacts to an epitope present on a homologous pancreatitis associated protein is a B lymphocyte.

3. The method of claim 2, wherein the immunoreactivity of the B lymphocyte can be assayed using Western blotting or an enzyme linked immunoadsorbent assay (ELISA).

4. The method of claim 1, wherein the leukocyte that immunospecifically reacts to an epitope present on a homologous pancreatitis associated protein is a T lymphocyte.

5. The method of claim 4;

wherein the immunoreactivity of the T lymphocyte can be assayed using a T lymphocyte proliferation assay.

6. The method of claim 1, wherein the pancreatitis associated peptide ability to facilitate pancreatic cell growth can be measured in a [³H]TdR incorporation cell proliferation assay or a cellular adhesion assay.

7. The method of claim 6, wherein the mammal is a human individual identified as having a predisposition to Type I diabetes.

8. The method of claim 7, wherein the predisposition to Type I diabetes is determined by the presence of islet cell autoantibodies or insulin autoantibodies.

9. The method of claim 1, wherein the pancreatitis associated peptide comprising the amino acid sequence IGLHDPTQGTEPNGE (SEQ ID NO:

3) is linked to a heterologous polypeptide sequence.

10. The method of claim 1, wherein the pancreatitis associated peptide is conjugated to a polyol.

11. A method of stimulating neogenesis of pancreatic beta cells in an individual having a predisposition to Type I diabetes comprising:

(a) determining whether the mammalian subject possesses a T lymphocyte that is;

(i) reactive to the 175 amino acid pancreatitis associated polypeptide protein shown in SEQ ID NO;

1; and

(ii) not reactive to the pancreatitis associated polypeptide peptide shown in SEQ ID NO;

3; and

(b) administering to the subject a therapeutically effective amount of a pancreatitis associated peptide comprising the amino acid sequence shown in SEQ ID NO;

3.

12. A method of inhibiting the expression in a mammalian subject of an epitope present on the 175 amino acid pancreatitis associated polypeptide protein shown in SEQ ID NO:

1, wherein the epitope is recognized by an autoimmune T cell in Type I diabetes, the method comprising exposing a pancreatic ductal cell in the subject to an amount of a pancreatitis associated polypeptide peptide comprising the amino acid sequence shown in SEQ ID NO;

3 sufficient to stimulate beta cell neogenesis.

13. The method according to claim 12, wherein the expression of the 175 amino acid pancreatitis associated polypeptide protein shown in SEQ ID NO:

1 is measured via a northern blot analysis or polymerase chain reaction analysis.

14. The method of claim 12, wherein a pancreatitis associated polypeptide peptide mediated proliferative response of the pancreatic ductal cell is measured via [³H]TdR incorporation.

15. The method of claim 12, wherein the subject exhibits at least one factor associated with a predisposition to Type I diabetes.

16. The method of claim 15, wherein the factor associated with a predisposition to Type I diabetes is determined is the presence of islet cell autoantibodies or insulin autoantibodies.

17. The method of claim 16, wherein the factor associated with a predisposition to Type I diabetes is determined is the presence of an autoantibody that recognizes islet cell antigen 512 (ICA 512).

18. The method of claim 15, wherein the factor associated with a predisposition to Type I diabetes is determined is the presence of an autoimmune T-cell that recognizes an epitope present on the 175 amino acid pancreatitis associated polypeptide protein shown in SEQ ID NO:

1.

19. The method of claim 12, wherein the peptide is conjugated to a polyol.

20. A method of inhibiting the onset of Type I diabetes in a mammalian subject predisposed to Type I diabetes comprising administering to the subject a therapeutically effective amount of a pancreatitis associated polypeptide peptide comprising the amino acid sequence shown in SEQ ID NO:

3, wherein the mammalian subject is selected to have at least one leukocyte that is;

(a) immunospecifically reactive to the 175 amino acid pancreatitis associated polypeptide protein shown in SEQ ID NO;

1; and

(b) not immunospecifically reactive to the pancreatitis associated polypeptide peptide shown in SEQ ID NO;

3.

21. The method of claim 20, wherein the pancreatitis associated polypeptide peptide is administered to the subject via a continuous infusion pump.

22. The method of claim 20, further comprising administering a second agent selected from the group consisting of human insulin, human glucagon-like peptide 1 and Fas ligand.

23. The method of claim 20, wherein the immunospecific reactivity of the leukocyte can be assayed via a T lymphocyte proliferation assay.

24. The method of claim 20, wherein the pancreatitis associated polypeptide peptide is conjugated to a polyol.

25. A method of stimulating neogenesis of pancreatic beta cells in an individual having a predisposition to Type I diabetes comprising administering to the subject a pancreatitis associated polypeptide peptide comprising the amino acid sequence shown in SEQ ID NO:

3.

26. The method of claim 25, wherein the predisposition to Type I diabetes is determined by the presence of islet cell autoantibodies or insulin autoantibodies.

27. The method of claim 26, wherein the islet cell autoantibody recognizes islet cell antigen 512 (ICA 512).

28. The method of claim 25, wherein the predisposition to Type I diabetes is determined by the presence of T cells that recognize an epitope on the 175 amino acid pancreatitis associated polypeptide shown in SEQ ID NO:

1.

29. A method of inhibiting the onset of Type I diabetes in a mammalian subject predisposed to Type I diabetes comprising administering to the subject a therapeutically effective amount of a pancreatitis associated polypeptide peptide comprising the amino acid sequence shown in SEQ ID NO:

3, wherein the pancreatitis associated polypeptide peptide does not possess an epitope present in the pancreatitis associated polypeptide protein comprising the amino acid sequence shown in SEQ ID NO;

1 that is recognized by autoimmune T-cells in the individual.

30. A composition comprising a pancreatitis associated polypeptide peptide having the amino acid sequence shown in SEQ ID NO:

3 and a pharmaceutically acceptable carrier.

31. A composition comprising a pancreatitis associated polypeptide peptide having the amino acid sequence shown in SEQ ID NO:

3, wherein the peptide has an amino acid substitution at I104, G105, L106, H107, D108, P109, T110, Q111, G112, T113, E114, P115, N116, G117 or E118.