Dendritic cell receptor

• US 6,432,666 B1
• Filed: 03/18/1999
• Issued: 08/13/2002
• Est. Priority Date: 05/29/1996
• Status: Expired due to Term

• Current Assignee: The Corporation of the Trustees of the Order of the Sisters of Mercy in Queensland
• Original Assignee: The Corporation of the Trustees of the Order of the Sisters of Mercy in Queensland
• Inventors: Hart, Derek N.
• Primary Examiner(s): Eyler, Yvonne
• Assistant Examiner(s): HAMUD, FOZIA M
• Application Number:
  US09/194,612
• Time in Patent Office: 1,244 Days
• Field of Search: 435/69.1, 435/70.1, 435/71.1, 435/471, 435/325, 435/252.3, 435/320, 536/23.1, 536/23.5, 530/350
• US Class Current: 435/69.1
• CPC Class Codes: A61K 2039/6031 Proteins
• CPC Class Codes: A61K 39/385 Haptens or antigens, bound to carriers
• CPC Class Codes: A61P 37/02 Immunomodulators
• CPC Class Codes: C07K 14/705 Receptors; Cell surface antigens; Cell surface determinants tumour specific antigens C07K14/4748
• CPC Class Codes: C07K 2319/00 Fusion polypeptide
• CPC Class Codes: G01N 33/56972 White blood cells

Abstract

An isolated human dendritic cell receptor comprising amino acid sequences selected from: TVDCNDNQPGAICYYSGNETEKEVKPVDSVKCPSPVLNTPWIPFQNCCYN FIITKNRHMATTQDEVQSTCEKLHPKSHILSIRDEKENNFVLEQLLYFNYMA SWVMLGITYRNNSL amino acid at position 1208-1323 of SEQ ID NO:1 and SQHRLFHLHSQKCLGLDITKSVNELRMFSCDSSAML amino acid at position 71-106 of SEQ ID NO:1.

Claims

1. An isolated human dendritic cell receptor comprising the amino acid sequence set forth in SEQ ID NO:

1.

2. An isolated human dendritic cell receptor according to claim 1 comprising amino acids 27 to 1722 of SEQ ID NO:

1.

3. An isolated human dendritic cell receptor according to claim 1 comprising amino acids 27 to 1661 of SEQ ID NO:

1.

4. An isolated polynucleotide sequence encoding the human dendritic cell receptor of claim 1 comprising the nucleotide sequence set forth in SEQ ID NO:

2 or a nucleotide sequence capable of hybridizing to SEQ ID NO;

2 or its complementary form under stringency conditions of a final wash in 0.1×

SSC, 0.5 w/v SDS at 65°

C.

5. An isolated vector comprising the polynucleotide sequence according to claim 4.

6. A method of producing a recombinant polypeptide comprising amino acid sequences derived from a human dendritic cell receptor, said method comprising culturing cells comprising the polynucleotide sequence according to claim 4 for a time and under conditions sufficient for the polynucleotide sequence to be expressed into said polypeptide and then recovering said polypeptide.