×

Protein scaffolds for antibody mimics and other binding proteins

  • US 6,818,418 B1
  • Filed: 02/29/2000
  • Issued: 11/16/2004
  • Est. Priority Date: 12/10/1998
  • Status: Expired due to Term
First Claim
Patent Images

1. A method for obtaining a scaffold-based protein that binds to a compound, said method comprising:

  • (a) contacting a compound with a library of scaffold-based proteins under conditions that allow binding to form a compound-scaffold-based protein complex, wherein the scaffold is derived from the tenth module of human fibronectin type III (10Fn3), said tenth module having the amino acid sequence, VSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGSKS TATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRT, said library comprising scaffold-based proteins having at least three randomized loops and being characterized by their ability to bind to a compound that is not bound by said human 10Fn3; and

    (b) obtaining, from said complex, a scaffold-based protein that binds to said compound and that has at least one amino acid alteration in each of three loops relative to the human 10Fn3 sequence.

View all claims
  • 6 Assignments
Timeline View
Assignment View
    ×
    ×