Humanized antibodies and compositions for binding sphingosine-1-phosphate
First Claim
Patent Images
1. An isolated humanized antibody that binds sphingosine-1-phosphate and comprises two heavy chains and two light chains, wherein:
- A. each heavy chain comprises a heavy chain variable domain comprising;
(i) a sequence of amino acid residues having an amino acid sequence EVQLVQSGAEVKKPGESLKISCQSFGYIFIDHTIHWMRQMPGQGLE WMGAISPRHDITKYNEMFRGQVTISADKSSSTAYLQWSSLKASDT AMYFCARGGFYGSTIWFDFWGQGTMVTVSS (SEQ ID NO;
32, residues 20-140, inclusive);
or(ii) a sequence of amino acid residues having at least about 80% sequence identity to the amino acid sequence of A(i), above, provided that in any event the heavy chain variable domain comprises a first complementarity determining region (CDR) comprising a sequence of amino acid residues DHTIH (SEQ ID NO;
13), a second CDR comprising a sequence of amino acid residues AISPRHDITKYNEMFRG (SEQ ID NO;
31), and a third CDR comprising a sequence of amino acid residues GGFYGSTIWFDF (SEQ ID NO;
15); and
B. each light chain comprises a light chain variable domain comprising;
(i) a sequence of amino acid residues having an amino acid sequence ETTVTQSPSFLSASVGDRVTITCITTTDIDDDMNWFQQEPG KAPKLLISEGNILRPGVPSRFSSSGYGTDFTLTISKLQPEDF ATYYCLQSDNLPFTFGQGTKLEIK (SEQ ID NO;
33, residues 21-127, inclusive);
or(ii) a sequence of amino acid residues having at least about 80% sequence identity to the amino acid sequence of B(i), above, provided that in any event the light chain variable domain comprises a first CDR comprising a sequence of amino acid residues ITTTDIDDDMN (SEQ ID NO;
10), a second CDR comprising a sequence of amino acid residues EGNILRP (SEQ ID NO;
11), and a third CDR comprising a sequence of amino acid residues LQSDNLPFT (SEQ ID NO;
12).
8 Assignments
0 Petitions
Accused Products
Abstract
The present invention relates to anti-S1P agents, particularly humanized monoclonal antibodies (and antigen binding fragments thereof) specifically reactive with S1P, compositions containing such antibodies (or fragments), and the use of such antibodies (or fragments), for example, to treat diseases and conditions associated with aberrant levels of S1P.
113 Citations
8 Claims
-
1. An isolated humanized antibody that binds sphingosine-1-phosphate and comprises two heavy chains and two light chains, wherein:
-
A. each heavy chain comprises a heavy chain variable domain comprising; (i) a sequence of amino acid residues having an amino acid sequence EVQLVQSGAEVKKPGESLKISCQSFGYIFIDHTIHWMRQMPGQGLE WMGAISPRHDITKYNEMFRGQVTISADKSSSTAYLQWSSLKASDT AMYFCARGGFYGSTIWFDFWGQGTMVTVSS (SEQ ID NO;
32, residues 20-140, inclusive);
or(ii) a sequence of amino acid residues having at least about 80% sequence identity to the amino acid sequence of A(i), above, provided that in any event the heavy chain variable domain comprises a first complementarity determining region (CDR) comprising a sequence of amino acid residues DHTIH (SEQ ID NO;
13), a second CDR comprising a sequence of amino acid residues AISPRHDITKYNEMFRG (SEQ ID NO;
31), and a third CDR comprising a sequence of amino acid residues GGFYGSTIWFDF (SEQ ID NO;
15); andB. each light chain comprises a light chain variable domain comprising; (i) a sequence of amino acid residues having an amino acid sequence ETTVTQSPSFLSASVGDRVTITCITTTDIDDDMNWFQQEPG KAPKLLISEGNILRPGVPSRFSSSGYGTDFTLTISKLQPEDF ATYYCLQSDNLPFTFGQGTKLEIK (SEQ ID NO;
33, residues 21-127, inclusive);
or(ii) a sequence of amino acid residues having at least about 80% sequence identity to the amino acid sequence of B(i), above, provided that in any event the light chain variable domain comprises a first CDR comprising a sequence of amino acid residues ITTTDIDDDMN (SEQ ID NO;
10), a second CDR comprising a sequence of amino acid residues EGNILRP (SEQ ID NO;
11), and a third CDR comprising a sequence of amino acid residues LQSDNLPFT (SEQ ID NO;
12). - View Dependent Claims (2, 3, 4, 5)
-
-
6. An isolated humanized antibody that binds sphingosine-1-phosphate, wherein:
-
A. each heavy chain comprises; i) an amino acid sequence that is the same as the amino acid sequence of the heavy chain encoded by the vector pATH1009 in ATCC Accession No. PTA-8421;
or(ii) a sequence of amino acid residues having at least about 80% sequence identity to the amino acid sequence of A(i), above, provided that in any event the heavy chain comprises a first complementarity determining region (CDR) comprising a sequence of amino acid residues DHTIH (SEQ ID NO;
13), a second CDR comprising a sequence of amino acid residues AISPRHDITKYNEMFRG (SEQ ID NO;
31), and a third CDR comprising a sequence of amino acid residues GGFYGSTIWFDF (SEQ ID NO;
15); andB. each light chain comprises; (i) an amino acid sequence that is the same as the amino acid sequence of the light chain encoded by the vector pATH1009 in ATCC Accession No. PTA-8421;
or(ii) a sequence of amino acid residues having at least about 80% sequence identity to the amino acid sequence of B(i), above, provided that in any event the light chain comprises a first CDR comprising a sequence of amino acid residues ITTTDIDDDMN (SEQ ID NO;
10), a second CDR comprising a sequence of amino acid residues EGNILRP (SEQ ID NO;
11), and a third CDR comprising a sequence of amino acid residues LQSDNLPFT (SEQ ID NO;
12). - View Dependent Claims (7, 8)
-
Specification