Protein agent for diabetes treatment and β cell imaging

  • US 8,697,648 B2
  • Filed: 10/20/2010
  • Issued: 04/15/2014
  • Est. Priority Date: 10/20/2009
  • Status: Active Grant
First Claim
Patent Images

1. A fusion protein comprising a first peptide, wherein the first peptide is glucagon-like peptide-1 (GLP-1), glucagon-like peptide-1 (GLP-1) (7-36), or glucagon-like peptide-1 (GLP-1) (9-36) linked to a second peptide, wherein the second peptide is a region of calbindin D9k, and wherein the fusion protein is more stable than the first peptide alone, the second peptide having an amino acid sequence selected from the group consisting of:

  • MSTKKSPEELKRIFEKYAAKEGDPDQLSKDELKLLIQAEFPSLLKGPNTLDDLFQELDKNG (SEQ ID NO;

         2), MSTKKSPEELKRIFEKYAAKEGDPDQLSKDELKLLIQAEFPCLLKGPNTLDDLFQELDKNG (SEQ ID NO;

         3), MSTKKSPCELKRIFEKYAAKEGDPDQLSKDELKLLIQAEFPSLLKGPNTLDDLFQELDKNG (SEQ ID NO;

         4), and MSTKKSPEELKRIFEKYAAKEGDPDDLSKDELKLLIQAEFPCLLKGPNTLDDLFQELDKNG (SEQ ID NO;

         17).

View all claims
    ×
    ×

    Thank you for your feedback

    ×
    ×