Biologically active peptides from functional domains of bactericidal/permeability-increasing protein and uses thereof

Biologically active peptides from functional domains of bactericidal/permeability-increasing protein and uses thereof

  • CN 100,396,695 C
  • Filed: 03/11/1994
  • Issued: 06/25/2008
  • Est. Priority Date: 03/12/1993
  • Status: Active Grant
First Claim
Patent Images

1. peptide, its aminoacid sequence is:

  • A) the aminoacid sequence of SEQ ID NO;

    69 from people'"'"'s bactericidal properties permeability-increasing protein matter (BPI) of 17 to 45;

    OrB) the above-mentioned a) subsequence of the aminoacid sequence of definition, it is selected from;

    ASQQGTAALQKELKRIKIPDYSDSFKIKH (SEQ?ID?NO:

    1);

    GTAALQKELKRIKIPDYSDSFKIKHLGKGH (SEQ?ID?NO:

    2);

    LQKELKRIKIPDYSDSFKIKHL (SEQ?ID?NO:

    3);

    QQGTAALQKELKRIK (SEQ?ID?NO:

    4);

    OrGTAALQKELKRIKIP (SEQ?ID?NO:

    5)Described peptide has at least a following BPI biological activity;

    heparin combination, heparin neutralization, LPS combination, LPS neutralize, kill bacterial activity and Fungicidally active.

View all claims
    ×
    ×

    Thank you for your feedback

    ×
    ×