Production of proteinase from gene recombinant pichia stipitis

Production of proteinase from gene recombinant pichia stipitis

  • CN 100,497,615 C
  • Filed: 11/25/2004
  • Issued: 06/10/2009
  • Est. Priority Date: 11/25/2004
  • Status: Active Grant
First Claim
Patent Images

1. a gene recombined Pichia pastoris is produced the method for neutral protease, it is characterized in that adopting Pichia pastoris to produce neutral protease, promptly adopt the method for polymerase chain reaction,PCR, from subtilis (Bacillus subtilus) 168, clone the complete sequence of coding neutral protease gene, be cloned into yeast expression vector PGAP then and obtain recon, recon transforms Pichia anomala expression host GS115 respectively, SMD1168, filter out the transformant that efficiently expresses of composing type then respectively, get genetic engineering bacterium GSp5 and SMDp18, this bacterium just can produce neutral protease in common dextrose culture-medium;

  • The coded aminoacid sequence of this complete sequence is as follows;

    MGLGKKLSVRVAASFMSLSISLPGVQAAEGHQLKENQTNFLSKKPIAQSELSAPNDKAVKQFLKKNSNIFKGDPSKSVKLVESTTDALGYKHFRYAPVVNGVPIKDSQVIVHVDKSDNVYAVNGELHNQSAAKTDNSQKVSSEKALALAFKAIGKSPDAVSNGAAKNSNKAELKAIETKDGSYRLAYDVTIRYVEPEPANWEVLVDAETGSILKQQNKVEHAAATGSGTTLKGATVPLNISYEGGKYVLRDLSKPTGTQIITYDLQNRQSRLPGTLVSSTTKTFTSSSQRAAVDAHYNLGKVYDYFYSNFKRNSYDNKGSKIVSSVHYGTQYNNAAWTGDQMIYGDGDGSFFSPLSGSLDVTAHEMTHGVTQETANLIYENQPGALNESFSDVFGYFNDTEDWDIGEDITVSQPALRSLSNPTKYNQPDNYANYRNLPNTDEGDYGGVHTNSGIPNKAAYNTITKLGVSKSQQIYYRALTTYLTPSSTFKDAKAALIQSARDLYGSTDAAKVEAAWNAVGL。

View all claims
    ×
    ×

    Thank you for your feedback

    ×
    ×