A CA6 antigen-specific cytotoxic conjugate and method of using the same

A CA6 antigen-specific cytotoxic conjugate and method of using the same

  • CN 101,242,855 A
  • Filed: 08/22/2005
  • Published: 08/13/2008
  • Est. Priority Date: 08/22/2005
  • Status: Active Application
First Claim
Patent Images

1. antibody or its epi-position binding fragment, comprise at least one variable region of heavy chain or its fragment and at least one variable region of light chain or its fragment, wherein said variable region of heavy chain or its fragment have at least 90% sequence homogeneity with the aminoacid sequence that is selected from SEQ ID NO:

  • 9, SEQ IDNO;

    10 and SEQ IDNO;

    11;

    QAYLQQSGAELVRSGASVKMSCKASGYTFTSYNMHWVKQTPGQGLEWIGYIYPGNGATNYNQKFKGKATLTADPSSSTAYMQISSLTSEDSAVYFCARGDSVPFAYWGQGTLVTVSA(SEQ?ID?NO:

    9)QAQLVQSGAEVVKPGASVKMSCKASGYTFTSYNMHWVKQTPGQGLEWIGYIYPGNGATNYNQKFQGKATLTADTSSSTAYMQISSLTSEDSAVYFCARGDSVPFAYWGQGTLVTVSA(SEQ?ID?NO:

    10)QAQLVQSGAEVVKPGASVKMSCKASGYTFTSYNMHWVKQTPGQGLEWIGYIYPGNGATNYNQKFQGKATLTADPSSSTAYMQISSLTSEDSAVYFCARGDSVPFAYWGQGTLVTVSA(SEQ?ID?NO:

    11)。

View all claims
    ×
    ×

    Thank you for your feedback

    ×
    ×