The mankind's telomerase catalytic subunit

The mankind's telomerase catalytic subunit

  • CN 102,021,153 B
  • Filed: 10/01/1997
  • Issued: 05/25/2016
  • Est. Priority Date: 10/01/1996
  • Status: Active Grant
First Claim
Patent Images

1. human telomerase reverse transcriptase'"'"'s polypeptide, wherein said polypeptide forms by being selected from following sequence:

  • FFYVTETTFQKNRLFFYRKSVWSK;

    RQHLKRVQLRDVSEAEVRQHREA;

    ARTFRREKRAERLTSRVKALFSVLNYE;

    AKFLHWLMSVYVVELLRSFFYVTETTFQ;

    LFFYRKSVWSKLQSIGIRQHLKRVQLRDVS;

    PALLTSRLRFIPKPDGLRPIVNMDYVV;

    The sequence of the 3272nd to 4177 nucleotide codings of the plasmid pGRN121 that is ATCC209016 by preserving number, andThe sequence of the 2426th to 3274 nucleotide codings of the plasmid pGRN121 that is ATCC209016 by preserving number.

View all claims
    ×
    ×

    Thank you for your feedback

    ×
    ×